PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g093310.1
Common NameMTR_2g093310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 199aa    MW: 22119 Da    PI: 4.6549
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g093310.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.11.3e-42331321100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+++++l+a+l
  Medtr2g093310.1  33 PCAACKILRRRCAEKCVLAPYFPPTEPSKFTTAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICHLQKEVNELQAQL 126
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a+ ++e
  Medtr2g093310.1 127 AKSQAE 132
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.30432133IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4233130IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MENDTNTQIS SLPFSQSPTS SQPPMAPQVV MSPCAACKIL RRRCAEKCVL APYFPPTEPS  60
KFTTAHRVFG ASNIIKFLQE LPESQRADAV SSMVYEASAR IRDPVYGCAG AICHLQKEVN  120
ELQAQLAKSQ AELINMQLQQ SNLLALICME MKETPNESPQ QSMDNFISSP AYSSDYQNNL  180
NFFEDNTSQN SLWEPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1923520.0AC192352.2 Medicago truncatula chromosome 2 BAC clone mte1-82k18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597159.11e-146lateral organ boundaries (LOB) domain protein
SwissprotQ9SK086e-81LBD11_ARATH; LOB domain-containing protein 11
TrEMBLG7IKN31e-146G7IKN3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA13G40370.21e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.16e-82LOB domain-containing protein 11
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]